The journey of Adinath Agro Processed Foods Pvt. Ltd began in the year 1989, with the promoters’ first venture into the domain of food processing, using the moniker of Adinath Food Industries. Adinath Food Industries continues to be a part of the Adinath Agro family since September 2013. Adinath Agro Processed Foods Pvt. Ltd is a privately held company which is primarily involved in the field of processing, marketing and exporting of assorted processed food products. After a presence spanning over two decades, consistently superior quality of products and excellent customer service, Adinath Agro has made a place for itself in the hearts of numerous Indians, with its brands Surabhi and WiNN emerging as two of the leading brands for processed fruit and vegetable products.
Winn’s Products
Tomato Ketchup
Winn Ketchup, truly made of fresh premium quality tomatoes is the most favourite table condiment. It is the best companion to every Indian & International snack or dish. Our ketchup is available in multiple sizes for your best use and convenience.
Canned Food
Our canned food range attributes to the finest quality of food. It is available at market place in several sizes & variants like Tomato Puree, Sweet Corn – Cream Style, Baby Corn in brine, Pineapple slice in syrup, Button Mushroom in brine, Red Cherries in syrup, Lychees in syrup, Fruit Cocktail in syrup, Baked beans, Sarson da saag – curried mustard leaves, Whole Corn Kernel in brine .
Fruit Jams
Bring back the most fond memories of your childhood with our immensely nostalgic range of fruit jams in five different flavours. Remembering our childhood fruit affair with Mixed Fruit Jam, Mango Jam, Orange Marmalade, Pineapple Jam , Strawberry Jam.
Mayonnaise
Take bite of heavenly food with the perfect use of our widest range of thick and creamy mayonnaise available in varied flavours like Cheesy mayo, Cheese and chilli mayo, Sandwich mayo, Mayonnaise lite, Tandoori, Cheese blend, Cheese Jalapeno Dip. Our range of yummy Dips and sauces include Mexican Salsa, Pizza pasta sauce, Barbeque sauce, Thousand island Dressing, Smoky dip, Tamarind sauce.
Chinese Sauce
Dip into the magical world full of finger licking flavours and taste. Why go eat outside food when you can prepare cheflike drooling Chinese food at the comfort of your home. Enjoy your food with our range of Winn Red Chilli Sauce, Green Chilli Sauce, Dark Soy Sauce, Cooking Vinegar and Schezwan Tadka – Dip & sauce.
|
|
|
Importfood.netisawidelyinfluentialprofessionalportalandmainstreammediaplatform,andasaprofessionalserviceorganization,withnearly... |
||||
EntrustedbytheEmbassyoftheRepublicofKoreainChina,KoreaAgriculture,FisheriesandFoodstuffsDistributionCorporation,KoreaTradeAssoci... |
||||
InJune2023,OuShang(TianJin)InternationalTradingCo,Ltdaftermanyunderstandingtopayattentiontotheimportfood.net,andformallybecomea... |
||||
In2023,IMPORTFOODandInterspanCanadahaveonceagainrenewedthecontract,markingthebeginningofthe12thyearofcollaboration.Bothofpar... |
||||
IMPORTFOODhasbeeninvitatedbyheorganizerofSIALandofferedhigh-qualitytradematchmakingservicesforoveradecade. Thisyear,atthee... |
||||
---------------------
Shantou
Add: 中国 汕头