Pulses and beans

Pulses and beans are one of the most versatile foods on the planet. Composed of dry peas, lentils, chickpeas and beans, they are fibre and protein-rich.

Learn all the range of Pulses & Beans we have to offer you.

Previous：No longer available!
Next：No longer available!

CASES

Importfood.net to help ANUGA FOOD CHINA in Shenzhen organized the "Food Talk Salon FOODCAST&qu...

Koelnmesse(Beijing)Co,Ltd,ChinaChamberofCommerceforImportandExportofFoodstuffs,NativeProduceandAnimalHusbandryandShenzhenRetail...

SIAL CHINA has been working with Importfood.net for 15 years.

Importfood.netisawidelyinfluentialprofessionalportalandmainstreammediaplatform,andasaprofessionalserviceorganization,withnearly...

The 2023 Korea Excellent Brand Exhibition was successfully held in Beijing on August 17 through the...

EntrustedbytheEmbassyoftheRepublicofKoreainChina,KoreaAgriculture,FisheriesandFoodstuffsDistributionCorporation,KoreaTradeAssoci...

OuShang(TianJin ) International Trading Co,Ltd joins forces with importfood.net to introduce quali...

InJune2023,OuShang(TianJin)InternationalTradingCo,Ltdaftermanyunderstandingtopayattentiontotheimportfood.net,andformallybecomea...

IMPORTFOOD and Interspan Canada continued the close partnership for 12 years, expanding the interna...

In2023,IMPORTFOODandInterspanCanadahaveonceagainrenewedthecontract,markingthebeginningofthe12thyearofcollaboration.Bothofpar...

IMPORTFOOD has been invitated by he organizer of SIAL and offered high-quality trade matchmaking se...

IMPORTFOODhasbeeninvitatedbyheorganizerofSIALandofferedhigh-qualitytradematchmakingservicesforoveradecade. Thisyear,atthee...

Contact Us
---------------------: CHINA
Shantou

15362309995 0754 88485995
Add: 中国汕头

��߷��