【AUSTRALIA】Protein Balls, Muesli Balls, Protein Crunch Bar, No Bake Cookies

Luv Sum is a market leader in the healthy snack food industry, being the first Australian-made brand and just the second worldwide to break from the traditional snack bars and innovate with the creation of protein balls, followed by muesli balls, nut butter bites and other original products.

Our high quality, delicious and nutritious snacks are available in over 22 countries, at more than 15,000 locations, and we continually originate with the release of new foods that complement a healthy lifestyle, as well as suit taste buds and dietary requirements around the world.

◆ If you are interested in"【AUSTRALIA】Protein Balls, Muesli Balls, Protein Crunch Bar, No Bake Cookies"please send us message here, We will take it seriously and contact you as soon as possible! Thank you!



Company:	*

Add:	*

Country:	*

Web:	*

Name:	*

Tel:	*

Mob:	*

WeChat:

E-mail:	*

Product Request:	*

Order Quantity:	*

Code:

Previous：No longer available!
Next：【AUSTRALIA】Healthy breakfast

CASES

Importfood.net to help ANUGA FOOD CHINA in Shenzhen organized the "Food Talk Salon FOODCAST&qu...

Koelnmesse(Beijing)Co,Ltd,ChinaChamberofCommerceforImportandExportofFoodstuffs,NativeProduceandAnimalHusbandryandShenzhenRetail...

SIAL CHINA has been working with Importfood.net for 15 years.

Importfood.netisawidelyinfluentialprofessionalportalandmainstreammediaplatform,andasaprofessionalserviceorganization,withnearly...

The 2023 Korea Excellent Brand Exhibition was successfully held in Beijing on August 17 through the...

EntrustedbytheEmbassyoftheRepublicofKoreainChina,KoreaAgriculture,FisheriesandFoodstuffsDistributionCorporation,KoreaTradeAssoci...

OuShang(TianJin ) International Trading Co,Ltd joins forces with importfood.net to introduce quali...

InJune2023,OuShang(TianJin)InternationalTradingCo,Ltdaftermanyunderstandingtopayattentiontotheimportfood.net,andformallybecomea...

IMPORTFOOD and Interspan Canada continued the close partnership for 12 years, expanding the interna...

In2023,IMPORTFOODandInterspanCanadahaveonceagainrenewedthecontract,markingthebeginningofthe12thyearofcollaboration.Bothofpar...

IMPORTFOOD has been invitated by he organizer of SIAL and offered high-quality trade matchmaking se...

IMPORTFOODhasbeeninvitatedbyheorganizerofSIALandofferedhigh-qualitytradematchmakingservicesforoveradecade. Thisyear,atthee...

Contact Us
---------------------: CHINA
Shantou

15362309995 0754 88485995
Add: 中国汕头

��߷��